PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0069s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 359aa    MW: 39280.6 Da    PI: 6.8559
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0069s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.54.7e-31186241156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r+ W+++LH+rF++ ++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Kalax.0069s0012.1.p 186 KQRRSWSQDLHRRFLHSLQQLGGADVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 241
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.028183243IPR017930Myb domain
SuperFamilySSF466891.08E-16184244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-27184244IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-26186241IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MQRQGDEYVR ALETERMKML VFQRELPLSI ELVSRAIESH RQQLSSSEET TSDCGPGLEF  60
IPLKKPTYAS SSGSEEHQQD LNLACVEDGS GGMDEGSEKS WHKSDWLRSV QLWNQSPDPP  120
PKSEEELSGE GLVEKKAKRS DKGEETKSVE EIHGQTNGSS TSETKEPQKS GGSKKEDREG  180
SLSRRKQRRS WSQDLHRRFL HSLQQLGGAD VATPKQIREL MKVDGLTNDE VKSHLQKYRL  240
HTRRPAPPPS QASGSEAQAP QFVVVGGVWA PPSDYTTMAL PVPANSEGDG ASGAPRSGVY  300
APMAAPPLAQ PHHPCQQFEF NQKPQVKSKN SESRGDGLAR CISLSMSSAT RSGPSPVC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-83PREDICTED: probable transcription factor GLK2
TrEMBLD7T9871e-83D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t014e-83(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.16e-71G2-like family protein